New Customers Sepcial: Get 15% off, use the code "NEW15" at checkout. Shop Now!
OXM(1-37)-biotin
Glucagon-Like Peptide 1 (GLP-1) (7-36)-Lys (Biotin), amide, human is an C-terminal-labelled biotinylated GLP-1 (7-36) amide.
Chemical | |
---|---|
CAS # | 1802086-70-9 |
Form | Lyophilized |
Molecular Formula | C165H252N44O48S |
Molecular Weight | 3256.3 |
Purity | >95% by HPLC |
Reconstitution | 1.10 mM; ultrasonic and adjust pH to 3 with HCl |
Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-(K-Biotin}-NH2ah |
Solubility | H2O : 4 mg/mL |
Shipping and Handling | |
Storage Condition | Store at -20°C |