New Customers Sepcial: Get 15% off, use the code "NEW15" at checkout. Shop Now!
OXM(1-37)
Oxyntomodulin (OXM), a 37-amino acid peptide hormone, causes weight loss in humans and rodents. It activates both the glucagon-like peptide-1 receptor (GLP1R) and the glucagon receptor (GCGR). It contains the same sequence as Glucagon (1-9), but with an additional KRNKNNIA C-terminal sequence.
Chemical | |
---|---|
CAS # | 62340-29-8 |
Form | Lyophilized |
Molecular Formula | C192H295N59O60S |
Molecular Weight | 4421.86 |
Purity | >95% by HPLC |
Reconstitution | Reconstitute with PBS or H20 to desired concentration. Due to the nature of this peptide, it is recommended to first mix with 10 ul of DMSO. |
Sequence | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH |
Solubility | Soluble to 1.10 mg/ml in water |
Shipping and Handling | |
Storage Condition | Store at -20°C |