New Customers Sepcial: Get 15% off, use the code "NEW15" at checkout. Shop Now!
Gastric Inhibitory Peptide (GIP), human
Product Code:
TDP-4220
Product price will show after you log in
GIP, also known as gastric inhibitory polypeptide, or glucose-dependent insulinotropic polypeptide, is a 42-amino-acid peptide hormone synthesized in and secreted from K cells in the intestinal epithelium. There are two major GIP molecular forms in circulation, GIP (1-42) and GIP(3-42). Previous studies have demonstrated that GIP (3-42) is a degraded form of GIP (1-42) by the enzyme DPPIV. GIP secretion is primarily regulated by nutrients, especially fat. GIP exhibits
| Chemical | |
|---|---|
| CAS # | 100040-31-1 |
| Form | Lyophilized |
| Molecular Formula | C226H338N60O66S |
| Molecular Weight | 4983.58 |
| Purity | >95% by HPLC |
| Reconstitution | Reconstitute with PBS or H20 to desired concentration. Due to the nature of this peptide, it is recommended to first mix with 10 ul of DMSO. |
| Sequence | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH |
| Solubility | Soluble to 1 mg/ml in water |
| Shipping and Handling | |
| Storage Condition | Store at -20°C |
