New Customers Sepcial: Get 15% off, use the code "NEW15" at checkout. Shop Now!

Peptides

Peptides are chains primarily composed of α-amino acids linked by amide bonds. They are found in all living organisms and perform a variety of biological roles, including as hormones, neurotransmitters, and immunogens. The functional versatility of peptides has increasingly been utilized in therapeutic and diagnostic applications.

Our peptides are ≥95% purified by HPLC with batch-to-batch reproducibility and available for immediate ordering.

TriDix also provides reliable custom peptide synthesis services with 100% guaranteed quantity at industry-leading speed to help expedite your research.

Corticotropin Releasing Factor, human, rat

Product Code: TDP-2480

Price: $239.00

Available Options

* Size:
5mg (+$860.00) 1mg

Qty: - +

CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRH plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance.

Chemical
CAS #	86784-80-7
Form	Lyophilized
Molecular Formula	C208H344N60O63S2
Molecular Weight	4758
Purity	>95% by HPLC
Reconstitution	Reconstitute with PBS or H20 to desired concentration. Due to the nature of this peptide, it is recommended to first mix with 10 ul of DMSO.
Sequence	SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
Solubility	Soluble to 1.10 mg/ml in water
Shipping and Handling
Storage Condition	Store at -20°C

Phone: +1 (619) 363-7998

Email: info@tridixbio.com

Office: 9636 TIERRA GRANDE ST, STE 104,
San Diego, CA 92126

Services

Products

Support

Follow Us at

Item 2