Image

New Customers Sepcial: Get 15% off, use the code "NEW15" at checkout. Shop Now!

Product Code: TDA-1201-100

Price: $0.00

Available Options

* Size:
- +

β-Amyloid peptide (Aβ40) is a 40-amino-acid peptide that plays a central role in the pathogenesis of Alzheimer’s disease (AD) and age-associated Down syndrome. In individuals with Down syndrome, trisomy of chromosome 21 leads to increased expression of amyloid precursor protein (APP), thereby promoting enhanced production and accumulation of Aβ peptides.

Aβ40 is generated through sequential proteolytic processing of the type I transmembrane protein APP, which is encoded by the APP gene located on human chromosome 21. Cleavage by β-secretase followed by γ-secretase produces multiple Aβ species of varying lengths, among which Aβ40 is the most abundant form.

Structurally, the Aβ peptide is derived from the extracellular N-terminal region of APP and extends into the transmembrane domain. The C-terminal region of Aβ40 is hydrophobic, conferring a strong propensity for self-association and aggregation into soluble oligomers, protofibrils, and mature amyloid fibrils. These aggregated species are widely implicated in neuronal dysfunction and disease progression in Alzheimer’s pathology.

TDA-1201-100-datasheet.pdf

Chemical
Conjugation No tag
Purity >97%
Sequence DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Biological
Organism Human
Protein Length/Size 40 amino acid/4329 Da
Shipping and Handling
Physical State Power
Shipped Product Format Ambient
Storage Temperature -80℃ for long term storage; avoid freeze/thaw cycle
Image

Phone: +1 (619) 363-7998

Office: 9636 TIERRA GRANDE ST, STE 104,
San Diego, CA 92126

Services

Products

Support

Follow Us at

  • Item 2
Image