New Customers Sepcial: Get 15% off, use the code "NEW15" at checkout. Shop Now!
New Customers Sepcial: Get 15% off, use the code "NEW15" at checkout. Shop Now!
Alpha-synuclein (SNCA) is predominantly expressed in the brain and is enriched at presynaptic nerve terminals. It is also localized to mitochondria in several brain regions, including the olfactory bulb, hippocampus, striatum, and thalamus. Alpha-synuclein interacts with tubulin and has been proposed to function as a microtubule-associated protein, contributing to synaptic and cytoskeletal regulation.
Pathologically, fibrillar alpha-synuclein aggregates are a major component of Lewy bodies in Parkinson’s disease and constitute a significant non–amyloid-β component of amyloid plaques in Alzheimer’s disease. The accumulation of alpha-synuclein– and ubiquitin-containing inclusions in vulnerable neuronal populations is a defining feature of Parkinson’s disease–associated neurodegeneration.
| Chemical | |
|---|---|
| CAS # | 131438-79-4 |
| Conjugation | No tag |
| Purity | >95% by SDS-PAGE |
| Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Biological | |
| Organism | Human |
| Protein Length/Size | 40 amino acid/4329 Da |
| Shipping and Handling | |
| Shipped Product Format | Cryopreserved / Dry ice |
| Storage Buffer | Phosphate buffer (PB) pH 7.4 |
| Storage Temperature | -80℃ for long term storage; avoid freeze/thaw cycle |