New Customers Sepcial: Get 15% off, use the code "NEW15" at checkout. Shop Now!
Peptides
Peptides are chains primarily composed of α-amino acids linked by amide bonds. They are found in all living organisms and perform a variety of biological roles, including as hormones, neurotransmitters, and immunogens. The functional versatility of peptides has increasingly been utilized in therapeutic and diagnostic applications.
Our peptides are ≥95% purified by HPLC with batch-to-batch reproducibility and available for immediate ordering.
TriDix also provides reliable custom peptide synthesis services with 100% guaranteed quantity at industry-leading speed to help expedite your research.
(Pro3) Gastric Inhibitory Peptide (GIP), human
(Pro3) GIP, human ((Pro3) Gastric Inhibitory Peptide, human) is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human has high binding affinity for human GIPR with Ki/ Kd values of 0.90 nM. (Pro3) GIP, human can be used for the research of obesity-related diabetes.GIP exhibits
| Chemical | |
|---|---|
| CAS # | 299898-52-5 |
| Form | Lyophilized |
| Molecular Formula | C226H338N60O64S |
| Molecular Weight | 4951.6 |
| Purity | >95% by HPLC |
| Reconstitution | Reconstitute with PBS or H20 to desired concentration. Due to the nature of this peptide, it is recommended to first mix with 10 ul of DMSO. |
| Sequence | YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH |
| Solubility | Soluble to 1 mg/ml in water |
| Shipping and Handling | |
| Storage Condition | Store at -20°C |
