New Customers Sepcial: Get 15% off, use the code "NEW15" at checkout. Shop Now!
(Pro3) Gastric Inhibitory Peptide (GIP), human
(Pro3) GIP, human ((Pro3) Gastric Inhibitory Peptide, human) is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human has high binding affinity for human GIPR with Ki/ Kd values of 0.90 nM. (Pro3) GIP, human can be used for the research of obesity-related diabetes.GIP exhibits
| Chemical | |
|---|---|
| CAS # | 299898-52-5 |
| Form | Lyophilized |
| Molecular Formula | C226H338N60O64S |
| Molecular Weight | 4951.6 |
| Purity | >95% by HPLC |
| Reconstitution | Reconstitute with PBS or H20 to desired concentration. Due to the nature of this peptide, it is recommended to first mix with 10 ul of DMSO. |
| Sequence | YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH |
| Solubility | Soluble to 1 mg/ml in water |
| Shipping and Handling | |
| Storage Condition | Store at -20°C |


