Image

New Customers Sepcial: Get 15% off, use the code "NEW15" at checkout. Shop Now!

Peptides

Peptides are chains primarily composed of α-amino acids linked by amide bonds. They are found in all living organisms and perform a variety of biological roles, including as hormones, neurotransmitters, and immunogens. The functional versatility of peptides has increasingly been utilized in therapeutic and diagnostic applications.

Our peptides are ≥95% purified by HPLC with batch-to-batch reproducibility and available for immediate ordering.

TriDix also provides reliable custom peptide synthesis services with 100% guaranteed quantity at industry-leading speed to help expedite your research.

Image
Product Code: TDP-4224

Price: $109.00

Available Options

* Size:
- +

(Pro3) GIP, human ((Pro3) Gastric Inhibitory Peptide, human) is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human has high binding affinity for human GIPR with Ki/ Kd values of 0.90 nM. (Pro3) GIP, human can be used for the research of obesity-related diabetes.GIP exhibits

Chemical
CAS # 299898-52-5
Form Lyophilized
Molecular Formula C226H338N60O64S
Molecular Weight 4951.6
Purity >95% by HPLC
Reconstitution Reconstitute with PBS or H20 to desired concentration. Due to the nature of this peptide, it is recommended to first mix with 10 ul of DMSO.
Sequence YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH
Solubility Soluble to 1 mg/ml in water
Shipping and Handling
Storage Condition Store at -20°C
Image

Phone: +1 (619) 363-7998

Office: 6195 Cornerstone Ct. E., Suite 107
San Diego, CA 92121

Services

Products

Support

Follow Us at

  • Item 2
Image