New Customers Sepcial: Get 15% off, use the code "NEW15" at checkout. Shop Now!
Neuropeptide Y (human, rat)
Neuropeptide Y (NPY) is a 36-amino acid endogenous neuropeptide which is involved in a variety of physiological and homeostatic processes, including food intake, sexual behavior and blood pressure. NPY is a vasonconstrictor that inhibits Ca2+-activated K+ channels in vascular smooth muscle. This NPY amino acid sequence is homologous for human, rat, rabbit, and guinea pig.
| Chemical | |
|---|---|
| CAS # | 90880-35-6 |
| Form | Lyophilized |
| Molecular Formula | C189H285N55O57S |
| Molecular Weight | 4271.7 |
| Purity | >95% by HPLC |
| Reconstitution | Reconstitute with PBS or H20 to desired concentration. Due to the nature of this peptide, it is recommended to first mix with 10 ul of DMSO. |
| Sequence | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-CONH2 |
| Solubility | Soluble to 1 mg/ml in water |
| Shipping and Handling | |
| Storage Condition | Store at -20°C |


