New Customers Sepcial: Get 15% off, use the code "NEW15" at checkout. Shop Now!
Glucagon Like Peptide-1 (7-37)
Glucagon-Like Peptide-1 (7-37) is a naturally occurring, biologically active form of GLP-1, a hormone derived from the proglucagon gene. It consists of 31 amino acids and plays a key role in glucose homeostasis. GLP-1 (7-37) stimulates insulin secretion in a glucose-dependent manner, inhibits glucagon release, slows gastric emptying, and reduces appetite, making it important in the regulation of blood sugar levels and a target for type 2 diabetes and obesity treatments.
| Chemical | |
|---|---|
| CAS # | CAS 106612-94-6 |
| Form | Lyophilized |
| Molecular Formula | C151H228N40O47 |
| Molecular Weight | 3355.9 g/mol |
| Purity | >95% by HPLC |
| Reconstitution | Reconstitute with PBS or H20 to desired concentration. Due to the nature of this peptide, it is recommended to first mix with DMSO. |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Solubility | Soluble to 1 mg/ml in water |
| Shipping and Handling | |
| Storage Condition | Store at -20°C |


