New Customers Sepcial: Get 15% off, use the code "NEW15" at checkout. Shop Now!
Gastric Inhibitory Polypeptide (GIP)
Gastric Inhibitory Polypeptide (GIP), also known as glucose-dependent insulinotropic polypeptide, is a peptide hormone consisting of 42 amino acids. It's synthesized and secreted by K cells in the intestinal epithelium, primarily in the duodenum and jejunum, in response to food intake, particularly fats and glucose.
| Chemical | |
|---|---|
| CAS # | 100040-31-1 |
| Form | Lyophilized |
| Molecular Formula | C226H338N60O66S1 |
| Molecular Weight | 4983.6 g/mol |
| Purity | >95% by HPLC |
| Reconstitution | Reconstitute with PBS or H20 to desired concentration. Due to the nature of this peptide, it is recommended to first mix with DMSO. |
| Sequence | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
| Solubility | Soluble in Ultrapure water under 1mg/ml |
| Shipping and Handling | |
| Storage Condition | Store at -20°C |


