New Customers Sepcial: Get 15% off, use the code "NEW15" at checkout. Shop Now!
Corticotropin Releasing Factor, human, rat
CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRH plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance.
| Chemical | |
|---|---|
| CAS # | 86784-80-7 |
| Form | Lyophilized |
| Molecular Formula | C208H344N60O63S2 |
| Molecular Weight | 4758 |
| Purity | >95% by HPLC |
| Reconstitution | Reconstitute with PBS or H20 to desired concentration. Due to the nature of this peptide, it is recommended to first mix with 10 ul of DMSO. |
| Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 |
| Solubility | Soluble to 1.10 mg/ml in water |
| Shipping and Handling | |
| Storage Condition | Store at -20°C |


